PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g038275m
Common NameCISIN_1g038275mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family B3
Protein Properties Length: 284aa    MW: 32932.5 Da    PI: 9.0418
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g038275mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B341.52.3e-133781798
                       E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                 B3 17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                       ++p kf++++g++   s + tl  ++gr W+v+l  ++  g++++ +GW +F+k   + +g + +Fk+ ++s+f  +v +f+
  orange1.1g038275m  3 RIPPKFVRDFGHE--LSEDATLAVPNGRPWRVRL--KRDEGGVWFDDGWYDFAKYYSVSAGYISIFKYGKNSNF--RVLIFD 78
                       69********965..8899***************..********************************998999..888876 PP

2B342.21.4e-13192274590
                        -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                 B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                         +ps++ +++r+++p +fa+++ +  ++s+++++ +e+ + +++++++r ++ ++ l+    e v++ +LkegD+++F+l++++ +
  orange1.1g038275m 192 ILPSSSITHNRVYVPATFAKHFASRDAKSMEVRVSNERHKFMNMNVCWRENG-GFALS--MTELVEDENLKEGDIFIFELISKRVA 274
                        5699***************88888899*******************877765.66666..89*****************9976555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086313.437180IPR003340B3 DNA binding domain
SMARTSM010191.4E-4180IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-18280IPR015300DNA-binding pseudobarrel domain
CDDcd100176.35E-14378No hitNo description
SuperFamilySSF1019361.04E-17382IPR015300DNA-binding pseudobarrel domain
PfamPF023623.0E-11378IPR003340B3 DNA binding domain
PROSITE profilePS508637.091188283IPR003340B3 DNA binding domain
SMARTSM010190.0069188281IPR003340B3 DNA binding domain
SuperFamilySSF1019366.87E-9190272IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.3E-8192277IPR015300DNA-binding pseudobarrel domain
PfamPF023627.4E-12192274IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MQRIPPKFVR DFGHELSEDA TLAVPNGRPW RVRLKRDEGG VWFDDGWYDF AKYYSVSAGY  60
ISIFKYGKNS NFRVLIFDFT ACEINYKREE GSKLDKRSRQ SAANYSFENF KAKHKYRECE  120
PQIKKCRKEE LVEKNESDDG GGGDIEYNLW DLLTEMGICI SKKHRAFSTE ESKRVLKIAR  180
SLNLKYPTSL IILPSSSITH NRVYVPATFA KHFASRDAKS MEVRVSNERH KFMNMNVCWR  240
ENGGFALSMT ELVEDENLKE GDIFIFELIS KRVAVLNLSI YHL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006485077.10.0PREDICTED: putative B3 domain-containing protein Os04g0346900 isoform X1
TrEMBLA0A067ER320.0A0A067ER32_CITSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3340322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01580.12e-24B3 family protein